Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUSD4 Rabbit Polyclonal Antibody (FITC)

SUSD4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRO222

UniProt

Q5VX71

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SUSD4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060452

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAP2C Human Over-expression Lysate
orb1370613 20 µg

RAP2C Human Over-expression Lysate

Sign In for Pricing
View Details
BAD, Phosphorylated (S71) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)
MBS6277407-01 0.2 mL

BAD, Phosphorylated (S71) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)

Sign In for Pricing
View Details
BAD, Phosphorylated (S71) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)
MBS6277407-02 5x 0.2 mL

BAD, Phosphorylated (S71) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)

Sign In for Pricing
View Details
Mmu-miR-686 miRNA Agomir
orb1918690-01 5 nmol

Mmu-miR-686 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-686 miRNA Agomir
orb1918690-02 10 nmol

Mmu-miR-686 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-686 miRNA Agomir
orb1918690-03 20 nmol

Mmu-miR-686 miRNA Agomir

Sign In for Pricing
View Details