Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tapbpl Rabbit Polyclonal Antibody (HRP)

Tapbpl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAP, Tapbplr, BC017613, TAPBPL-R

UniProt

Q8VD31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RERALLVLKQVPVLDDGSLEGITDFQGSTETKQDSPVIFEASVDLVQIPQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663366

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC mu Rabbit pAb
E47R4156 100 µL

PKC mu Rabbit pAb

Sign In for Pricing
View Details
DPYSL2 Antibody
OAGA04319-100UL 100 µL

DPYSL2 Antibody

Sign In for Pricing
View Details
Rabbit Anti-FAK/PTK2 Polyclonal Antibody
PAV7172 100 μL

Rabbit Anti-FAK/PTK2 Polyclonal Antibody

Sign In for Pricing
View Details
FCAR, ID (FCAR, CD89, Immunoglobulin alpha Fc receptor, CD89) (FITC)
MBS6298585-01 0.2 mL

FCAR, ID (FCAR, CD89, Immunoglobulin alpha Fc receptor, CD89) (FITC)

Sign In for Pricing
View Details
FCAR, ID (FCAR, CD89, Immunoglobulin alpha Fc receptor, CD89) (FITC)
MBS6298585-02 5x 0.2 mL

FCAR, ID (FCAR, CD89, Immunoglobulin alpha Fc receptor, CD89) (FITC)

Sign In for Pricing
View Details
Tnnt2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4435903 1.0 µg DNA

Tnnt2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details