Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM82C Rabbit Polyclonal Antibody (HRP)

FAM82C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RMD3, RMD-3, FAM82C, FAM82A2, ptpip51

UniProt

Q96TC7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM82C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060615

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAV1 Antibody, HRP Conjugated
MBS7112813-01 0.05 mL

CAV1 Antibody, HRP Conjugated

Sign In for Pricing
View Details
CAV1 Antibody, HRP Conjugated
MBS7112813-02 0.1 mL

CAV1 Antibody, HRP Conjugated

Sign In for Pricing
View Details
CAV1 Antibody, HRP Conjugated
MBS7112813-03 5x 0.1 mL

CAV1 Antibody, HRP Conjugated

Sign In for Pricing
View Details
Mouse Runx1t1 ELISA Kit
EF016127 96 Tests

Mouse Runx1t1 ELISA Kit

Sign In for Pricing
View Details
Mospd3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
30338116 3x 1.0 µg

Mospd3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Small Stress Protein-Like Protein HSP22 (HSP22) Antibody (ATTO 565)
abx447421 100 µL

Small Stress Protein-Like Protein HSP22 (HSP22) Antibody (ATTO 565)

Sign In for Pricing
View Details