Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lgi2 Rabbit Polyclonal Antibody (FITC)

Lgi2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MKIAA1916

UniProt

Q8K4Z0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPEYQEKKLNEVTSFDYECTTTGPQTDEAKQRGWQLELSLGFCELIFVFQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITFG1, CT (ITFG1, TIP, T-cell immunomodulatory protein, Integrin-alpha FG-GAP repeat-containing protein 1) (MaxLight 550)
MBS6311143-01 0.1 mL

ITFG1, CT (ITFG1, TIP, T-cell immunomodulatory protein, Integrin-alpha FG-GAP repeat-containing protein 1) (MaxLight 550)

Sign In for Pricing
View Details
ITFG1, CT (ITFG1, TIP, T-cell immunomodulatory protein, Integrin-alpha FG-GAP repeat-containing protein 1) (MaxLight 550)
MBS6311143-02 5x 0.1 mL

ITFG1, CT (ITFG1, TIP, T-cell immunomodulatory protein, Integrin-alpha FG-GAP repeat-containing protein 1) (MaxLight 550)

Sign In for Pricing
View Details
GAL, ID (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (MaxLight 650)
MBS6301068-01 0.1 mL

GAL, ID (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (MaxLight 650)

Sign In for Pricing
View Details
GAL, ID (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (MaxLight 650)
MBS6301068-02 5x 0.1 mL

GAL, ID (GAL, GAL1, GALN, GLNN, Galanin peptides, Galanin, Galanin message-associated peptide) (MaxLight 650)

Sign In for Pricing
View Details
Anti-Integrin alpha V beta 6 Antibody, Rabbit Polyclonal
MBS8113355-01 0.1 mL

Anti-Integrin alpha V beta 6 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Integrin alpha V beta 6 Antibody, Rabbit Polyclonal
MBS8113355-02 5x 0.1 mL

Anti-Integrin alpha V beta 6 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details