Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf75 Rabbit Polyclonal Antibody (HRP)

C1orf75 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAC, ASOR, hPAC, PAORAC, C1orf75, TMEM206, hTMEM206

UniProt

Q9H813

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf75

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060722

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-SIN3B Antibody
YLD7181-01 50 µL

Rabbit anti-SIN3B Antibody

Sign In for Pricing
View Details
Rabbit anti-SIN3B Antibody
YLD7181-02 100 µL

Rabbit anti-SIN3B Antibody

Sign In for Pricing
View Details
Ciliary Neurotropic Factor (CNTF) (MaxLight 405) discontinued
C5073-05-ML405 100 µL

Ciliary Neurotropic Factor (CNTF) (MaxLight 405) discontinued

Sign In for Pricing
View Details
POGK Antibody (HRP)
orb25358-01 50 µg

POGK Antibody (HRP)

Sign In for Pricing
View Details
POGK Antibody (HRP)
orb25358-02 100 µg

POGK Antibody (HRP)

Sign In for Pricing
View Details
Magic™ Membrane Protein Mouse Fam189b (Family with sequence similarity 189, member B) Expressed in vitro E.coli expression system, Full Length
MPX2607K Each

Magic™ Membrane Protein Mouse Fam189b (Family with sequence similarity 189, member B) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details