Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCTP2 Rabbit Polyclonal Antibody (FITC)

MCTP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6DN12

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MCTP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IRTFTPREKRFVEDSRKLSKKILSRDVDRVKRITMAIWNTMQFLKSCFQW

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel CD4 Antibody (Anti-CD4) ELISA Kit
MBS9396537 Inquire

Camel CD4 Antibody (Anti-CD4) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human SLC9A5 sgRNA gene knockout kit - Lentiviral human SLC9A5 sgRNA gene knockout kit (plasmid)
GTR15380456 1 Vial

Lentiviral human SLC9A5 sgRNA gene knockout kit - Lentiviral human SLC9A5 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
C6orf147 sgRNA CRISPR Lentivector (Human) (Target 3)
K0248604 1.0 µg DNA

C6orf147 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
LOC360479 Protein Vector (Rat) (pPM-C-HA)
27144026 500 ng

LOC360479 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human Annexin A2 ELISA Kit
orb1659283 96 Tests

Human Annexin A2 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal VRK1 Antibody (OTI2C9) - Azide and BSA Free
NBP2-74855 100 µg

Mouse Monoclonal VRK1 Antibody (OTI2C9) - Azide and BSA Free

Sign In for Pricing
View Details