Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCTP2 Rabbit Polyclonal Antibody (FITC)

MCTP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6DN12

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MCTP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IRTFTPREKRFVEDSRKLSKKILSRDVDRVKRITMAIWNTMQFLKSCFQW

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Antibody togroup A streptococcal polysaccharide, ASP) ELISA Kit
EIA05066Ch 1 Kit

Chicken Antibody togroup A streptococcal polysaccharide, ASP) ELISA Kit

Sign In for Pricing
View Details
MicroGripper Assembly; box of 20 assemblies
B-M7-50-B3S 20 Mounts/Base Assemblies

MicroGripper Assembly; box of 20 assemblies

Sign In for Pricing
View Details
Hira Mouse shRNA Plasmid (Locus ID 15260)
TF500962 1 Kit

Hira Mouse shRNA Plasmid (Locus ID 15260)

Sign In for Pricing
View Details
MTOR (Phospho-Ser2448) Antibody FITC Conjugated
orb1542378 100 µL

MTOR (Phospho-Ser2448) Antibody FITC Conjugated

Sign In for Pricing
View Details
CASP3 Knockout A-549 Cell Line
ARG0072 1 Million

CASP3 Knockout A-549 Cell Line

Sign In for Pricing
View Details
Pts (NM_011220) Mouse Tagged ORF Clone
MG200948 10 µg

Pts (NM_011220) Mouse Tagged ORF Clone

Sign In for Pricing
View Details