Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAPTM4B Rabbit Polyclonal Antibody (FITC)

LAPTM4B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LC27, LAPTM4beta

UniProt

Q86VI4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LAPTM4B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060877

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF2RA (Colony Stimulating Factor 2 Receptor Alpha, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838) (FITC)
MBS6412617-01 0.1 mL

CSF2RA (Colony Stimulating Factor 2 Receptor Alpha, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838) (FITC)

Sign In for Pricing
View Details
CSF2RA (Colony Stimulating Factor 2 Receptor Alpha, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838) (FITC)
MBS6412617-02 5x 0.1 mL

CSF2RA (Colony Stimulating Factor 2 Receptor Alpha, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838) (FITC)

Sign In for Pricing
View Details
Mouse Glutaminase kidney isoform, mitochondrial ELISA Kit
MBS2885936-01 48 Well

Mouse Glutaminase kidney isoform, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Glutaminase kidney isoform, mitochondrial ELISA Kit
MBS2885936-02 96 Well

Mouse Glutaminase kidney isoform, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Glutaminase kidney isoform, mitochondrial ELISA Kit
MBS2885936-03 5x 96 Well

Mouse Glutaminase kidney isoform, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Glutaminase kidney isoform, mitochondrial ELISA Kit
MBS2885936-04 10x 96 Well

Mouse Glutaminase kidney isoform, mitochondrial ELISA Kit

Sign In for Pricing
View Details