Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAC Rabbit Polyclonal Antibody (HRP)

SAC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a

UniProt

Q96PN6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SAC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

187kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 20 (IL20) Antibody
abx404826-01 100 µL

Interleukin 20 (IL20) Antibody

Sign In for Pricing
View Details
Interleukin 20 (IL20) Antibody
abx404826-02 200 µL

Interleukin 20 (IL20) Antibody

Sign In for Pricing
View Details
Interleukin 20 (IL20) Antibody
abx404826-03 1 mL

Interleukin 20 (IL20) Antibody

Sign In for Pricing
View Details
FITC human CD8α Antibody
orb3066269-01 25 Tests

FITC human CD8α Antibody

Sign In for Pricing
View Details
FITC human CD8α Antibody
orb3066269-02 100 Tests

FITC human CD8α Antibody

Sign In for Pricing
View Details
Mouse Rho Guanine Nucleotide Exchange Factor 6, ARHGEF6 GENLISA ELISA
KLM1361 96 Well

Mouse Rho Guanine Nucleotide Exchange Factor 6, ARHGEF6 GENLISA ELISA

Sign In for Pricing
View Details