Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY10 Rabbit Polyclonal Antibody (Biotin)

ADCY10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a

UniProt

Q96PN6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence LMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

187 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_060887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homeobox-containing protein 1 antibody
orb73742 100 µL

Homeobox-containing protein 1 antibody

Sign In for Pricing
View Details
CD276 Rabbit Polyclonal Antibody
APRab08323-01 20 µL

CD276 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD276 Rabbit Polyclonal Antibody
APRab08323-02 50 µL

CD276 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD276 Rabbit Polyclonal Antibody
APRab08323-03 100 µL

CD276 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD276 Rabbit Polyclonal Antibody
APRab08323-04 200 µL

CD276 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC679509 3'UTR GFP Stable Cell Line
TU260451 1.0 mL

LOC679509 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details