Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY10 Rabbit Polyclonal Antibody (FITC)

ADCY10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a

UniProt

Q96PN6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence LMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

187 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_060887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-1972 miRNA Agomir
abx880858-01 5 nmol

Human hsa-miR-1972 miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-1972 miRNA Agomir
abx880858-02 10 nmol

Human hsa-miR-1972 miRNA Agomir

Sign In for Pricing
View Details
Canine Adenovirus,AdV ELISA KIT
JOT-EKD0014Ca 96 wells

Canine Adenovirus,AdV ELISA KIT

Sign In for Pricing
View Details
N Cadherin Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-52389R-BF350-TR 20 µL

N Cadherin Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
USP9X Protein Lysate (Mouse) with C-HA Tag
49345034 100 µg

USP9X Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
LCO siRNA Oligos set (Human)
26392171 3x 5 nmol

LCO siRNA Oligos set (Human)

Sign In for Pricing
View Details