Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY10 Rabbit Polyclonal Antibody (HRP)

ADCY10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a

UniProt

Q96PN6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence LMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

187 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_060887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dyrk3 3'UTR Luciferase Stable Cell Line
TU203726 1.0 mL

Dyrk3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Phospho-BRIP1/BACH1 (Ser990) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-5226R-BF680 100 µL

Phospho-BRIP1/BACH1 (Ser990) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit anti-DOCK2 Antibody, Affinity Purified
MBS3905534-01 0.01 mg

Rabbit anti-DOCK2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DOCK2 Antibody, Affinity Purified
MBS3905534-02 0.1 mg

Rabbit anti-DOCK2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DOCK2 Antibody, Affinity Purified
MBS3905534-03 5x 0.01 mg

Rabbit anti-DOCK2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DOCK2 Antibody, Affinity Purified
MBS3905534-04 5x 0.1 mg

Rabbit anti-DOCK2 Antibody, Affinity Purified

Sign In for Pricing
View Details