Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Styk1 Rabbit Polyclonal Antibody (Biotin)

Styk1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Nok, AI326477, 9130025L13

UniProt

Q6J9G1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Styk1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YHIGKQILLALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Perinuclear anti-neutrophil cytoplasmic antibody, pANCA ELISA KIT
ED0068Mo-01 96 Well

Mouse Perinuclear anti-neutrophil cytoplasmic antibody, pANCA ELISA KIT

Sign In for Pricing
View Details
Samd4b Rat shRNA Plasmid (Locus ID 308473)
TL706054 1 Kit

Samd4b Rat shRNA Plasmid (Locus ID 308473)

Sign In for Pricing
View Details
A2AP Rabbit Polyclonal Antibody
MBS9513201-01 0.05 mL

A2AP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
A2AP Rabbit Polyclonal Antibody
MBS9513201-02 0.1 mL

A2AP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
A2AP Rabbit Polyclonal Antibody
MBS9513201-03 5x 0.1 mL

A2AP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GPR175 Polyclonal Antibody
PA86100HU-01 50 µg

Rabbit Anti-Human GPR175 Polyclonal Antibody

Sign In for Pricing
View Details