Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FIG4 Rabbit Polyclonal Antibody (FITC)

FIG4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

YVS, BTOP, SAC3, ALS11, CMT4J, KIAA0274, dJ249I4.1

UniProt

Q92562

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence NSQQPCSRCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQAS

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSQQPCSRCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQAS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

104 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_055660

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human 4-1BB/TNFRSF9/CD137 (C-Fc)
32-8774-50 50 µg

Recombinant Human 4-1BB/TNFRSF9/CD137 (C-Fc)

Sign In for Pricing
View Details
LY 487379 hydrochloride
sc-204065 10 mg

LY 487379 hydrochloride

Sign In for Pricing
View Details
Rat Cfd Pre-designed siRNA Set A
SI202639A 1 Each

Rat Cfd Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human TRIM31 Knockout HEK293T cell line
GTR15403115 1 Vial

Human TRIM31 Knockout HEK293T cell line

Sign In for Pricing
View Details
Hal ORF Vector (Mouse) (pORF)
ORF046963 1.0 µg DNA

Hal ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
[D-SER]32-Mazdutide
RP30904-5 5 mg

[D-SER]32-Mazdutide

Sign In for Pricing
View Details