Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT23 Rabbit Polyclonal Antibody (HRP)

KRT23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K23, CK23, HAIK1

UniProt

Q9C075

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KRT23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_056330

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) Antibody Pair Kit (with Standard)
MBS2103458-01 5x 96 Tests

Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) Antibody Pair Kit (with Standard)
MBS2103458-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) Antibody Pair Kit (with Standard)
MBS2103458-03 10x 96 Tests

Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) Antibody Pair Kit (with Standard)
MBS2103458-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
CD109 (CD109 Antigen, 150kD TGF-beta-1-binding Protein, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 7, Platelet-specific Gov Antigen, p180, r150, CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1) (FITC)
124516-FITC 100 µL

CD109 (CD109 Antigen, 150kD TGF-beta-1-binding Protein, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 7, Platelet-specific Gov Antigen, p180, r150, CPAMD7, DKFZp762L1111, FLJ38569, FLJ41966, RP11-525G3.1) (FITC)

Sign In for Pricing
View Details
DUSP21
CSB-CL875677HU 10 μg Plasmid + 200 μL Glycerol

DUSP21

Sign In for Pricing
View Details