Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGM2 Rabbit Polyclonal Antibody (FITC)

TGM2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TGC, tTG, G (h), hTG2, TG (C)

UniProt

P21980

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TGM2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004604

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Fibroblast Growth Factor 23 ELISA Kit
MBS042935-01 48 Well

Monkey Fibroblast Growth Factor 23 ELISA Kit

Sign In for Pricing
View Details
Monkey Fibroblast Growth Factor 23 ELISA Kit
MBS042935-02 96 Well

Monkey Fibroblast Growth Factor 23 ELISA Kit

Sign In for Pricing
View Details
Monkey Fibroblast Growth Factor 23 ELISA Kit
MBS042935-03 5x 96 Well

Monkey Fibroblast Growth Factor 23 ELISA Kit

Sign In for Pricing
View Details
Monkey Fibroblast Growth Factor 23 ELISA Kit
MBS042935-04 10x 96 Well

Monkey Fibroblast Growth Factor 23 ELISA Kit

Sign In for Pricing
View Details
Sulbactam Impurity 64
RM-S212332-01 10 mg

Sulbactam Impurity 64

Sign In for Pricing
View Details
Sulbactam Impurity 64
RM-S212332-02 100 mg

Sulbactam Impurity 64

Sign In for Pricing
View Details