Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCMA/TNFRSF17, Mouse (HEK293, Fc)

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM) . BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Mouse (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It is produced in HEK293 cells.

Product Specifications

Product Name Alternative

BCMA/TNFRSF17 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcma-tnfrsf17-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYT

Molecular Formula

21935 (Gene_ID) O88472-1 (M1-T49) (Accession)

Molecular Weight

35-45 kDa

References & Citations

[1]Gavriatopoulou M, et al. Anti-BCMA antibodies in the future management of multiple myeloma. Expert Rev Anticancer Ther. 2019;19 (4) :319-326.|[2]Wang Y, et al. BCMA-targeting Bispecific Antibody That Simultaneously Stimulates NKG2D-enhanced Efficacy Against Multiple Myeloma. J Immunother. 2020;43 (6) :175-188.|[3]Nobari ST, et al. B-cell maturation antigen targeting strategies in multiple myeloma treatment, advantages and disadvantages. J Transl Med. 2022 Feb 10;20 (1) :82.|[4]Yu B, et al. BCMA-targeted immunotherapy for multiple myeloma. J Hematol Oncol. 2020 Sep 17;13 (1) :125.|[5]Perez-Amill L, et al. Preclinical development of a humanized chimeric antigen receptor against B cell maturation antigen for multiple myeloma. Haematologica. 2021 Jan 1;106 (1) :173-184.|[6]Sanchez E, et al. Soluble B-Cell Maturation Antigen Mediates Tumor-Induced Immune Deficiency in Multiple Myeloma. Clin Cancer Res. 2016 Jul 1;22 (13) :3383-97.|[7]O'Connor BP, et al. BCMA is essential for the survival of long-lived bone marrow plasma cells. J Exp Med. 2004 Jan 5;199 (1) :91-8.|[8]Tai YT, et al. APRIL and BCMA promote human multiple myeloma growth and immunosuppression in the bone marrow microenvironment. Blood. 2016 Jun 23;127 (25) :3225-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl 2 Human (minus BH4 domain)
OM303576-01 2 µg

Bcl 2 Human (minus BH4 domain)

Sign In for Pricing
View Details
Bcl 2 Human (minus BH4 domain)
OM303576-02 10 µg

Bcl 2 Human (minus BH4 domain)

Sign In for Pricing
View Details
Bcl 2 Human (minus BH4 domain)
OM303576-03 1 mg

Bcl 2 Human (minus BH4 domain)

Sign In for Pricing
View Details
Recombinant Human OGN Protein, N-His
bs-101024P-01 20 µg

Recombinant Human OGN Protein, N-His

Sign In for Pricing
View Details
Recombinant Human OGN Protein, N-His
bs-101024P-02 50 µg

Recombinant Human OGN Protein, N-His

Sign In for Pricing
View Details
Klkb21 CRISPR Activation Plasmid (m2)
sc-421303-ACT-2 20 µg

Klkb21 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details