Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF37A Rabbit Polyclonal Antibody (FITC)

ZNF37A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KOX21, ZNF37

UniProt

P17032

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF37A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LIKHQRIHTGEKPYECNECGKSFSEKSTLTKHLRTHTGEKPYECIQCGKF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007095

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP36L2, ID (ZFP36L2, BRF2, ERF2, RNF162C, TIS11D, Zinc finger protein 36, C3H1 type-like 2, Butyrate response factor 2, EGF-response factor 2, Protein TIS11D) (MaxLight 750)
MBS6365159-01 0.1 mL

ZFP36L2, ID (ZFP36L2, BRF2, ERF2, RNF162C, TIS11D, Zinc finger protein 36, C3H1 type-like 2, Butyrate response factor 2, EGF-response factor 2, Protein TIS11D) (MaxLight 750)

Sign In for Pricing
View Details
ZFP36L2, ID (ZFP36L2, BRF2, ERF2, RNF162C, TIS11D, Zinc finger protein 36, C3H1 type-like 2, Butyrate response factor 2, EGF-response factor 2, Protein TIS11D) (MaxLight 750)
MBS6365159-02 5x 0.1 mL

ZFP36L2, ID (ZFP36L2, BRF2, ERF2, RNF162C, TIS11D, Zinc finger protein 36, C3H1 type-like 2, Butyrate response factor 2, EGF-response factor 2, Protein TIS11D) (MaxLight 750)

Sign In for Pricing
View Details
EWSR1 Antibody / EWS
R32181 100 µg

EWSR1 Antibody / EWS

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV C18L Protein, N-His
MBS1564888-01 0.1 mg

Recombinant Monkeypox virus/MPXV C18L Protein, N-His

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV C18L Protein, N-His
MBS1564888-02 1 mg

Recombinant Monkeypox virus/MPXV C18L Protein, N-His

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV C18L Protein, N-His
MBS1564888-03 5x 1 mg

Recombinant Monkeypox virus/MPXV C18L Protein, N-His

Sign In for Pricing
View Details