Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISX Rabbit Polyclonal Antibody (HRP)

ISX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pix-1, RAXLX

UniProt

Q2M1V0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ISX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRKSKRRV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008494

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methamphetamine (M-AMP) (HRP)
214450-HRP 100 µL

Methamphetamine (M-AMP) (HRP)

Sign In for Pricing
View Details
Atrial Natriuretic Peptide, mini-([Met5, Cys6,17, His7, Ser16, Tyr18, Arg19]-rANF (5-19) amide)
MBS659550-01 1 mg

Atrial Natriuretic Peptide, mini-([Met5, Cys6,17, His7, Ser16, Tyr18, Arg19]-rANF (5-19) amide)

Sign In for Pricing
View Details
Atrial Natriuretic Peptide, mini-([Met5, Cys6,17, His7, Ser16, Tyr18, Arg19]-rANF (5-19) amide)
MBS659550-02 5x 1 mg

Atrial Natriuretic Peptide, mini-([Met5, Cys6,17, His7, Ser16, Tyr18, Arg19]-rANF (5-19) amide)

Sign In for Pricing
View Details
Human ASAHL Affinity Purified Polyclonal Ab
AF4494-SP 25 µg

Human ASAHL Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
DMRT1 Antibody Blocking peptide
orb1451931 500 µg

DMRT1 Antibody Blocking peptide

Sign In for Pricing
View Details
SCN3A Human Gene Knockout Kit (CRISPR)
KN412211 1 Kit

SCN3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details