Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARGFX Rabbit Polyclonal Antibody (HRP)

ARGFX Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NJG6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARGFX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001012677

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOXO1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
32029126 3x 1.0µg DNA

NOXO1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 19F Carbamoyl-phosphate synthase large chain (carB), partial
MBS1027214 Inquire

Recombinant Streptococcus pneumoniae serotype 19F Carbamoyl-phosphate synthase large chain (carB), partial

Sign In for Pricing
View Details
Ribosomal Protein L34 Polyclonal Antibody
orb1412278 100 µL

Ribosomal Protein L34 Polyclonal Antibody

Sign In for Pricing
View Details
ZKSCAN4, CT (ZKSCAN4, ZNF307, ZNF427, Zinc finger protein with KRAB and SCAN domains 4, P373c6.1, Zinc finger protein 307, Zinc finger protein 427) (PE) discontinued
044091-PE 200 µL

ZKSCAN4, CT (ZKSCAN4, ZNF307, ZNF427, Zinc finger protein with KRAB and SCAN domains 4, P373c6.1, Zinc finger protein 307, Zinc finger protein 427) (PE) discontinued

Sign In for Pricing
View Details
Tyrosinase (TYR) Rabbit Polyclonal Antibody
AP06471PU-N 100 µg

Tyrosinase (TYR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nitrofurazone (SEM) ELISA Kit
JOT-SEM-FS-01 48T

Nitrofurazone (SEM) ELISA Kit

Sign In for Pricing
View Details