Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXK1 Rabbit Polyclonal Antibody (HRP)

FOXK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FOXK1L

UniProt

P85037

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSDLQLAAEFAAKAASEQQADTSGGDSPKDESKPPFSYAQLIVQAISSAQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001032242

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TBC1D28 Antibody (OTI4A9) [Alexa Fluor 488]
NBP2-74461AF488 0.1 mL

Mouse Monoclonal TBC1D28 Antibody (OTI4A9) [Alexa Fluor 488]

Sign In for Pricing
View Details
Actin Alpha 2, Smooth Muscle (ACTa2) Monoclonal Antibody
CAU30722-01 100 µL

Actin Alpha 2, Smooth Muscle (ACTa2) Monoclonal Antibody

Sign In for Pricing
View Details
Actin Alpha 2, Smooth Muscle (ACTa2) Monoclonal Antibody
CAU30722-02 200 µL

Actin Alpha 2, Smooth Muscle (ACTa2) Monoclonal Antibody

Sign In for Pricing
View Details
Actin Alpha 2, Smooth Muscle (ACTa2) Monoclonal Antibody
CAU30722-03 1 mL

Actin Alpha 2, Smooth Muscle (ACTa2) Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral human NUBP1 shRNA (UAS) - Lentiviral human NUBP1 shRNA (UAS, GFP) plasmid
GTR15313981 1 Vial

Lentiviral human NUBP1 shRNA (UAS) - Lentiviral human NUBP1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Atp1b3 siRNA Oligos set (Rat)
12679176 3x 5 nmol

Atp1b3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details