Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN12 Rabbit Polyclonal Antibody (Biotin)

ZSCAN12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2

UniProt

O43309

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001034732

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC47A1 shRNA (UAS) - Lentiviral human SLC47A1 shRNA (UAS, iRFP) plasmid
GTR15317095 1 Vial

Lentiviral human SLC47A1 shRNA (UAS) - Lentiviral human SLC47A1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
GLDN Rabbit Polyclonal Antibody
JOT-AP10185-01 20 µL

GLDN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GLDN Rabbit Polyclonal Antibody
JOT-AP10185-02 50 μL

GLDN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GLDN Rabbit Polyclonal Antibody
JOT-AP10185-03 100 µL

GLDN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAPPA (Pregnancy Associated Plasma Protein A, PAPP-A, PAPA, ASBABP2, DIPLA1, IGFBP-4ase, PAPPA1, Pappalysin 1, Insulin-Like Growth Factor Binding Protein-4 Protease, Differentially Placenta 1 Expressed Protein)
364521 200 µL

PAPPA (Pregnancy Associated Plasma Protein A, PAPP-A, PAPA, ASBABP2, DIPLA1, IGFBP-4ase, PAPPA1, Pappalysin 1, Insulin-Like Growth Factor Binding Protein-4 Protease, Differentially Placenta 1 Expressed Protein)

Sign In for Pricing
View Details
Lentiviral human SERPINC1 sgRNA gene knockout kit - Lentiviral human SERPINC1 sgRNA gene knockout kit (plasmid)
GTR15371861 1 Vial

Lentiviral human SERPINC1 sgRNA gene knockout kit - Lentiviral human SERPINC1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details