Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN12 Rabbit Polyclonal Antibody (HRP)

ZSCAN12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2

UniProt

O43309

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001034732

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AE Binding Protein 1 (AEBP1) Human ELISA Kit
B3290 96 Tests

AE Binding Protein 1 (AEBP1) Human ELISA Kit

Sign In for Pricing
View Details
HNF1A Polyclonal Antibody, Cy7 Conjugated
bs-25295R-Cy7 100 µL

HNF1A Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Anti-Heat Shock Protein Beta 6 (HSPB6)
FY-AB45575-01 1 mL

Anti-Heat Shock Protein Beta 6 (HSPB6)

Sign In for Pricing
View Details
Anti-Heat Shock Protein Beta 6 (HSPB6)
FY-AB45575-02 100 µL

Anti-Heat Shock Protein Beta 6 (HSPB6)

Sign In for Pricing
View Details
Anti-Heat Shock Protein Beta 6 (HSPB6)
FY-AB45575-03 200 µL

Anti-Heat Shock Protein Beta 6 (HSPB6)

Sign In for Pricing
View Details
LHFPL5 Rabbit mAb
E60M0909 100 µL

LHFPL5 Rabbit mAb

Sign In for Pricing
View Details