Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-8/LGALS8, Human (GST)

Galectin-8/LGALS8 protein is an important enzyme in the glycosylation process, acting as β-1,3-N-acetylglucosaminyltransferase to synthesize poly-N-acetyllactosamine. Galectin-8/LGALS8 is essential for modifying glycoproteins and glycolipids, catalyzes the transfer of N-acetylglucosamine to acceptor molecules, and exhibits specific activity on type 2 oligosaccharides. Galectin-8/LGALS8 Protein, Human (GST) is the recombinant human-derived Galectin-8/LGALS8 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Galectin-8/LGALS8 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-8-lgals8-protein-human-gst.html

Smiles

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Molecular Formula

3964 (Gene_ID) O00214-1 (M1-W317) (Accession)

Molecular Weight

62.8 kDa

References & Citations

[1]Wang Y, et al. Galectin-8 alters immune microenvironment and promotes tumor progression. Am J Cancer Res. 2023 Jun 15;13 (6) :2517-2529.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal SMARCA1 Antibody
NBP1-83087-25ul 25 µL

Rabbit Polyclonal SMARCA1 Antibody

Ask
View Details
C3 Rabbit Monoclonal Antibody
E56G4506 100 µL

C3 Rabbit Monoclonal Antibody

Ask
View Details
LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1) (MaxLight 650)
129084-ML650 100 µL

LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1) (MaxLight 650)

Ask
View Details
MYO3A (NM_017433) Human Mutant ORF Clone
RC403208 10 µg

MYO3A (NM_017433) Human Mutant ORF Clone

Ask
View Details