Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMX1 Rabbit Polyclonal Antibody (HRP)

EMX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q04741

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EMX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004088

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLNK Antibody, HRP conjugated
A63502-100UG 100 µg

BLNK Antibody, HRP conjugated

Sign In for Pricing
View Details
Rat UDP-Glucumno-Syltransferase 1 Family Polypeptide A1 ELISA Kit
MBS3808668-01 48 Well

Rat UDP-Glucumno-Syltransferase 1 Family Polypeptide A1 ELISA Kit

Sign In for Pricing
View Details
Rat UDP-Glucumno-Syltransferase 1 Family Polypeptide A1 ELISA Kit
MBS3808668-02 96 Well

Rat UDP-Glucumno-Syltransferase 1 Family Polypeptide A1 ELISA Kit

Sign In for Pricing
View Details
Rat UDP-Glucumno-Syltransferase 1 Family Polypeptide A1 ELISA Kit
MBS3808668-03 5x 96 Well

Rat UDP-Glucumno-Syltransferase 1 Family Polypeptide A1 ELISA Kit

Sign In for Pricing
View Details
Rat UDP-Glucumno-Syltransferase 1 Family Polypeptide A1 ELISA Kit
MBS3808668-04 10x 96 Well

Rat UDP-Glucumno-Syltransferase 1 Family Polypeptide A1 ELISA Kit

Sign In for Pricing
View Details
PEX6 Antibody
orb848506 2 mg

PEX6 Antibody

Sign In for Pricing
View Details