Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMX1 Rabbit Polyclonal Antibody (HRP)

EMX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q04741

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EMX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004088

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAPH1 (NM_203365) Human Over-expression Lysate
LS065059-20ug 20 µg

RAPH1 (NM_203365) Human Over-expression Lysate

Sign In for Pricing
View Details
NOSTRIN Antibody
MBS153699-01 0.1 mg

NOSTRIN Antibody

Sign In for Pricing
View Details
NOSTRIN Antibody
MBS153699-02 5x 0.1 mg

NOSTRIN Antibody

Sign In for Pricing
View Details
ZFP763 Adenovirus (Mouse)
51118054 1.0 mL

ZFP763 Adenovirus (Mouse)

Sign In for Pricing
View Details
Lentiviral human ARAP3 sgRNA gene knockout kit - Lentiviral human ARAP3 sgRNA gene knockout kit (25)
GTR15393450 1 Vial

Lentiviral human ARAP3 sgRNA gene knockout kit - Lentiviral human ARAP3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Bovine A2 Microglobulin ELISA Kit
MBS030203-01 48 Well

Bovine A2 Microglobulin ELISA Kit

Sign In for Pricing
View Details