Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mafk Rabbit Polyclonal Antibody (HRP)

Mafk Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NF-E, Nfe2, NF-E2, Nfe2u, AW061068

UniProt

Q61827

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFGE8 Protein Vector (Mouse) (pPM-C-HA)
PV200536 500 ng

MFGE8 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
IL-10 Rat Monoclonal Antibody (PE)
orb2648273-01 20 Tests

IL-10 Rat Monoclonal Antibody (PE)

Sign In for Pricing
View Details
IL-10 Rat Monoclonal Antibody (PE)
orb2648273-02 100 Tests

IL-10 Rat Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Boc-(S)-3-Amino-3-(3-bromo-phenyl)-propionic acid
MBS9024391-01 1 g

Boc-(S)-3-Amino-3-(3-bromo-phenyl)-propionic acid

Sign In for Pricing
View Details
Boc-(S)-3-Amino-3-(3-bromo-phenyl)-propionic acid
MBS9024391-02 5x 1 g

Boc-(S)-3-Amino-3-(3-bromo-phenyl)-propionic acid

Sign In for Pricing
View Details
Lentiviral mouse Ring1 shRNA (UAS) - Lentiviral mouse Ring1 shRNA (UAS) plasmid
GTR15277387 1 Vial

Lentiviral mouse Ring1 shRNA (UAS) - Lentiviral mouse Ring1 shRNA (UAS) plasmid

Sign In for Pricing
View Details