Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAFK Rabbit Polyclonal Antibody (Biotin)

MAFK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P18, NFE2U

UniProt

O60675

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAFK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002351

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DCTN6 Antibody Picoband® Biotin Conjugated
A15043-Biotin 100 µg/Vial

Anti-DCTN6 Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
Quinpirole Hydrochloride
T12606 1 mg

Quinpirole Hydrochloride

Sign In for Pricing
View Details
Dnmt3A, CT (Dnmt3A2, DNMT3A, DNA (cytosine-5) -methyltransferase 3A, DNA methyltransferase HsaIIIA) (MaxLight 550) discontinued
034746-ML550 100 µL

Dnmt3A, CT (Dnmt3A2, DNMT3A, DNA (cytosine-5) -methyltransferase 3A, DNA methyltransferase HsaIIIA) (MaxLight 550) discontinued

Sign In for Pricing
View Details
RPL4 Antibody
61-310 200 µL

RPL4 Antibody

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae Phosphothreonine lyase ospF (ospF)
MBS1338059-01 0.02 mg (E-Coli)

Recombinant Shigella dysenteriae Phosphothreonine lyase ospF (ospF)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae Phosphothreonine lyase ospF (ospF)
MBS1338059-02 0.1 mg (E-Coli)

Recombinant Shigella dysenteriae Phosphothreonine lyase ospF (ospF)

Sign In for Pricing
View Details