Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAFK Rabbit Polyclonal Antibody (HRP)

MAFK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, NFE2U

UniProt

O60675

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAFK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002351

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIIP Antibody Blocking Peptide
orb1503283 500 µg

MIIP Antibody Blocking Peptide

Sign In for Pricing
View Details
HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (HRP)
MBS6152846-01 0.1 mL

HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (HRP)

Sign In for Pricing
View Details
HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (HRP)
MBS6152846-02 5x 0.1 mL

HDAC3 (Histone Deacetylase 3, HD3, RPD3-2, SMAP45, RPD3) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Pon2 shRNA (UAS) - Lentiviral mouse Pon2 shRNA (UAS, GFP) plasmid
GTR15206122 1 Vial

Lentiviral mouse Pon2 shRNA (UAS) - Lentiviral mouse Pon2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ABCB5 ELISA Kit (Human) (OKAN05645)
OKAN05645 96 Well

ABCB5 ELISA Kit (Human) (OKAN05645)

Sign In for Pricing
View Details
Human Interleukin-18 Receptor 1, IL18R1 ELISA Kit
BPE179-01 96 Tests

Human Interleukin-18 Receptor 1, IL18R1 ELISA Kit

Sign In for Pricing
View Details