Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF131 Rabbit Polyclonal Antibody (FITC)

ZNF131 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZBTB35, pHZ-10

UniProt

P52739

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF131

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit
MBS2514792-01 24 Tests

Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit

Sign In for Pricing
View Details
Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit
MBS2514792-02 48 Test

Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit

Sign In for Pricing
View Details
Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit
MBS2514792-03 96 Tests

Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit

Sign In for Pricing
View Details
Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit
MBS2514792-04 5x 96 Tests

Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit

Sign In for Pricing
View Details
Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit
MBS2514792-05 10x 96 Tests

Porcine TSTA (Tumor Specific Transplantation Antigen) ELISA Kit

Sign In for Pricing
View Details
CNGA2, NT (CNGA2, CNCA, CNCA1, CNCG2, Cyclic nucleotide-gated olfactory channel, Cyclic nucleotide-gated cation channel 2, Cyclic nucleotide-gated channel alpha-2) (FITC) discontinued
034038-FITC 200 µL

CNGA2, NT (CNGA2, CNCA, CNCA1, CNCG2, Cyclic nucleotide-gated olfactory channel, Cyclic nucleotide-gated cation channel 2, Cyclic nucleotide-gated channel alpha-2) (FITC) discontinued

Sign In for Pricing
View Details