Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZKSCAN1 Rabbit Polyclonal Antibody (FITC)

ZKSCAN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KOX18, ZNF36, PHZ-37, ZNF139, ZSCAN33

UniProt

P17029

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZKSCAN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003430

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (KRT7/903), CF647 conjugate, 0.1mg/mL
BNC470903-100 1x 100 µL

Cytokeratin 7 (KRT7/903), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H4 (Acetyl-Lys16) Antibody
8D0014-AAT 50 µg

Histone H4 (Acetyl-Lys16) Antibody

Sign In for Pricing
View Details
Cystathionase (CTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]
TA502442AM 100 µL

Cystathionase (CTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), 1mg/mL
BNUM3261-50 1x 50 µL

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), 1mg/mL

Sign In for Pricing
View Details
CCL8 Antibody
KC-2842-01 50 μL

CCL8 Antibody

Sign In for Pricing
View Details
CCL8 Antibody
KC-2842-02 100 µL

CCL8 Antibody

Sign In for Pricing
View Details