Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp7 Rabbit Polyclonal Antibody (Biotin)

Vamp7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Syb, VAM, Sybl1, VAMP-7, TI-VAMP

UniProt

P70280

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035645

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP3 Rabbit Polyclonal Antibody (APC)
orb1005994 100 µL

IGFBP3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mmp7 3'UTR GFP Stable Cell Line
TU163289 1.0 mL

Mmp7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TRPV6 Rabbit Polyclonal Antibody
orb511389 100 µg

TRPV6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), CF640R conjugate, 0.1mg/mL
BNC401746-500 1x 500 µL

Human Herpes Virus 8 (HHV8) (LN53), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ELISA Kit for Casein Beta (CSN2)
TRV-0000793-01 24 Tests

ELISA Kit for Casein Beta (CSN2)

Sign In for Pricing
View Details
ELISA Kit for Casein Beta (CSN2)
TRV-0000793-02 48 Tests

ELISA Kit for Casein Beta (CSN2)

Sign In for Pricing
View Details