Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF256 Rabbit Polyclonal Antibody (HRP)

ZNF256 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BMZF3, BMZF-3

UniProt

Q9Y2P7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF256

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LYHDVMLENLTLTTSLGGSGAGDEEAPYQQSTSPQRVSQVRIPKALPSPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_005764

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F (ab') 2 Rat IgG (H&L) Antibody Biotin Conjugated
orb348360 500 µg

F (ab') 2 Rat IgG (H&L) Antibody Biotin Conjugated

Sign In for Pricing
View Details
CHRNA9 Rabbit pAb, IRDye 800CW conjugated
orb2861466 100 µL

CHRNA9 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
IL20RA Antibody / IL-20 receptor subunit alpha
V5185SAF-100UG 100 µg

IL20RA Antibody / IL-20 receptor subunit alpha

Sign In for Pricing
View Details
CD134 (CD134 Antigen, ACT35, ACT35 Antigen, Lymphoid Activation Antigen ACT35, OX40, OX40 Cell Surface Antigen, OX40 Homolog, OX40L Receptor, RP5-902P8.3, TAX Transcriptionally-activated Glycoprotein 1 Receptor, Tumor Necrosis Factor Receptor Superfamily
MBS6248502-01 0.1 mL

CD134 (CD134 Antigen, ACT35, ACT35 Antigen, Lymphoid Activation Antigen ACT35, OX40, OX40 Cell Surface Antigen, OX40 Homolog, OX40L Receptor, RP5-902P8.3, TAX Transcriptionally-activated Glycoprotein 1 Receptor, Tumor Necrosis Factor Receptor Superfamily

Sign In for Pricing
View Details
CD134 (CD134 Antigen, ACT35, ACT35 Antigen, Lymphoid Activation Antigen ACT35, OX40, OX40 Cell Surface Antigen, OX40 Homolog, OX40L Receptor, RP5-902P8.3, TAX Transcriptionally-activated Glycoprotein 1 Receptor, Tumor Necrosis Factor Receptor Superfamily
MBS6248502-02 5x 0.1 mL

CD134 (CD134 Antigen, ACT35, ACT35 Antigen, Lymphoid Activation Antigen ACT35, OX40, OX40 Cell Surface Antigen, OX40 Homolog, OX40L Receptor, RP5-902P8.3, TAX Transcriptionally-activated Glycoprotein 1 Receptor, Tumor Necrosis Factor Receptor Superfamily

Sign In for Pricing
View Details
IgE (HRP) discontinued
I1900-19-HRP 100 µL

IgE (HRP) discontinued

Sign In for Pricing
View Details