Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF256 Rabbit Polyclonal Antibody (Biotin)

ZNF256 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BMZF3, BMZF-3

UniProt

Q9Y2P7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZN256

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLQQQAAHTRKKSNRTKSAVAFHSVKNHYNWGECVKAFSYKHVRVQHQGD

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paxillin Ser272 Rabbit Polyclonal Antibody
E53P05524 100 µL

Paxillin Ser272 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FMO4 Rabbit Polyclonal Antibody (Biotin)
orb2118298 100 µL

FMO4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Monoclonal HIF-2 alpha/EPAS1 Antibody (2597C) [DyLight 680]
NBP3-07075FR 0.1 mL

Rabbit Monoclonal HIF-2 alpha/EPAS1 Antibody (2597C) [DyLight 680]

Sign In for Pricing
View Details
ELAVL4 Protein Lysate (Human) with C-Ha Tag
19198031 100 µg

ELAVL4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (AP)
MBS6134073-01 0.1 mL

SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (AP)

Sign In for Pricing
View Details
SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (AP)
MBS6134073-02 5x 0.1 mL

SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (AP)

Sign In for Pricing
View Details