Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PA2G4 Rabbit Polyclonal Antibody (Biotin)

PA2G4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EBP1, HG4-1, p38-2G4

UniProt

Q9UQ80

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PA2G4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-29b-1-5p miRNA Mimic
CMM0371-01 5 nmol

Mmu-miR-29b-1-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-29b-1-5p miRNA Mimic
CMM0371-02 10 nmol

Mmu-miR-29b-1-5p miRNA Mimic

Sign In for Pricing
View Details
KIR2DS3, CT (KIR2DS3, NKAT7, Killer cell immunoglobulin-like receptor 2DS3, MHC class I NK cell receptor, Natural killer-associated transcript 7) (Azide free) (HRP)
MBS6313417-01 0.2 mL

KIR2DS3, CT (KIR2DS3, NKAT7, Killer cell immunoglobulin-like receptor 2DS3, MHC class I NK cell receptor, Natural killer-associated transcript 7) (Azide free) (HRP)

Sign In for Pricing
View Details
KIR2DS3, CT (KIR2DS3, NKAT7, Killer cell immunoglobulin-like receptor 2DS3, MHC class I NK cell receptor, Natural killer-associated transcript 7) (Azide free) (HRP)
MBS6313417-02 5x 0.2 mL

KIR2DS3, CT (KIR2DS3, NKAT7, Killer cell immunoglobulin-like receptor 2DS3, MHC class I NK cell receptor, Natural killer-associated transcript 7) (Azide free) (HRP)

Sign In for Pricing
View Details
AdmiRa-hsa-mir-1268b Virus
mh1180 250 µL

AdmiRa-hsa-mir-1268b Virus

Sign In for Pricing
View Details
CDKN2A Antibody
orb2671259-01 50 µL

CDKN2A Antibody

Sign In for Pricing
View Details