Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PA2G4 Rabbit Polyclonal Antibody (FITC)

PA2G4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EBP1, HG4-1, p38-2G4

UniProt

Q9UQ80

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PA2G4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Styrene-d8 (Stabilized with Hydroquinone)
TRC-S687793-1G 1 g

Styrene-d8 (Stabilized with Hydroquinone)

Sign In for Pricing
View Details
hCG beta Recombinant Rabbit Monoclonal Antibody [JE45-04]
HA721437 100 µL

hCG beta Recombinant Rabbit Monoclonal Antibody [JE45-04]

Sign In for Pricing
View Details
Acetylsalicylic Anhydride
TRC-A187785-250MG 250 mg

Acetylsalicylic Anhydride

Sign In for Pricing
View Details
Recombinant Mouse TIMP1 Protein (His Tag)
PDEM100223-01 20 µg

Recombinant Mouse TIMP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TIMP1 Protein (His Tag)
PDEM100223-02 100 µg

Recombinant Mouse TIMP1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TIMP1 Protein (His Tag)
PDEM100223-03 500 µg

Recombinant Mouse TIMP1 Protein (His Tag)

Sign In for Pricing
View Details