Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PA2G4 Rabbit Polyclonal Antibody (HRP)

PA2G4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EBP1, HG4-1, p38-2G4

UniProt

Q9UQ80

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PA2G4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMDEC1 (N-term) Rabbit Polyclonal Antibody
AP50081PU-N 400 µL

ADAMDEC1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CAP2 activation kit by CRISPRa
GA107161 1 Kit

Human CAP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Lung Specific Antigen (LSA120), CF568 conjugate, 0.1mg/mL
BNC680120-100 1x 100 µL

Lung Specific Antigen (LSA120), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-03 2x 100 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details