Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morf4l1 Rabbit Polyclonal Antibody (HRP)

Morf4l1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRG1, MORFR, MRG15, Tex189, TEG-189, MORFRG15, mKIAA4002

UniProt

P60762

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034236

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinol Binding Protein 2, Cellular (RBP2) Antibody
abx103760-01 100 µL

Retinol Binding Protein 2, Cellular (RBP2) Antibody

Sign In for Pricing
View Details
Retinol Binding Protein 2, Cellular (RBP2) Antibody
abx103760-02 200 µL

Retinol Binding Protein 2, Cellular (RBP2) Antibody

Sign In for Pricing
View Details
Retinol Binding Protein 2, Cellular (RBP2) Antibody
abx103760-03 1 mL

Retinol Binding Protein 2, Cellular (RBP2) Antibody

Sign In for Pricing
View Details
SuLT1A4 (NM_001017389) Human Recombinant Protein
TP322321 20 µg

SuLT1A4 (NM_001017389) Human Recombinant Protein

Sign In for Pricing
View Details
ENTPD3 Protein, Mouse, Recombinant (His Tag)
MBS8122650-01 0.1 mg

ENTPD3 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
ENTPD3 Protein, Mouse, Recombinant (His Tag)
MBS8122650-02 1 mg

ENTPD3 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details