Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD2 Rabbit Polyclonal Antibody (FITC)

SETD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LLS, HYPB, SET2, HIF-1, HIP-1, KMT3A, HBP231, HSPC069, p231HBP

UniProt

Q9BYW2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SETD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAH72440

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1566319 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
39439156 3x 1.0 µg DNA

RGD1566319 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Mouse Monoclonal Integrin beta 1/CD29 Antibody (4B7R) [HRP]
FAB1778H 0.1 mL

Mouse Monoclonal Integrin beta 1/CD29 Antibody (4B7R) [HRP]

Sign In for Pricing
View Details
Mouse Phosphoenolpyruvate Carboxykinase 2, Mitochondrial (PCK2) ELISA Kit
EKN53423 96 Tests

Mouse Phosphoenolpyruvate Carboxykinase 2, Mitochondrial (PCK2) ELISA Kit

Sign In for Pricing
View Details
Chicken Ribosome maturation protein SBDS, SBDS ELISA KIT
ELI-39255c 96 Tests

Chicken Ribosome maturation protein SBDS, SBDS ELISA KIT

Sign In for Pricing
View Details
KCNN2 Peptide - middle region
orb2019559 100 µg

KCNN2 Peptide - middle region

Sign In for Pricing
View Details
STT3B Peptide
DF12327-BP 1 mg

STT3B Peptide

Sign In for Pricing
View Details