Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF25 Rabbit Polyclonal Antibody (Biotin)

TCF25 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hulp1, NULP1, FKSG26, PRO2620, hKIAA1049

UniProt

Q9BQ70

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF25

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HRHLNPDTELKRYFGARAILGEQRPRQRQRVYPKCTWLTTPKSTWPRYSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P95 NBS1 (NBN) Mouse Monoclonal Antibody [Clone:1F11]
E45M14984 100 µg

P95 NBS1 (NBN) Mouse Monoclonal Antibody [Clone:1F11]

Sign In for Pricing
View Details
Rabbit Polyclonal Swine Influenza A H1N1 Hemagglutinin Antibody [DyLight 680]
NBP2-41107FR 0.1 mL

Rabbit Polyclonal Swine Influenza A H1N1 Hemagglutinin Antibody [DyLight 680]

Sign In for Pricing
View Details
Dusp12 3'UTR Luciferase Stable Cell Line
TU203682 1.0 mL

Dusp12 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FAM151B Antibody, Biotin conjugated
A58155-100UG 100 µg

FAM151B Antibody, Biotin conjugated

Sign In for Pricing
View Details
Collagen VII Rabbit pAb
E47R22189 100 µL

Collagen VII Rabbit pAb

Sign In for Pricing
View Details
Lentiviral human FXR1 shRNA (UAS) - Lentiviral human FXR1 shRNA (UAS, RFP) (25)
GTR15333698 1 Vial

Lentiviral human FXR1 shRNA (UAS) - Lentiviral human FXR1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details