Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF25 Rabbit Polyclonal Antibody (HRP)

TCF25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hulp1, NULP1, FKSG26, PRO2620, hKIAA1049

UniProt

Q9BQ70

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HRHLNPDTELKRYFGARAILGEQRPRQRQRVYPKCTWLTTPKSTWPRYSK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL16 | IL-16 Rabbit pAb, AP conjugated
orb3126440 100 µL

IL16 | IL-16 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
PRDX6 Protein
OPPA02207-5UG 5 µg

PRDX6 Protein

Sign In for Pricing
View Details
Human LINC02389 qPCR Primer Pair
QH76693S 200 Tests

Human LINC02389 qPCR Primer Pair

Sign In for Pricing
View Details
LOC100503615 3'UTR GFP Stable Cell Line
TU161850 1.0 mL

LOC100503615 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Pramel6 Protein Lysate (Mouse) with C-HA Tag
37554034 100 µg

Pramel6 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Human CEACAM6 Protein, His-SUMO, E.coli-10ug
QP5813-ec-10ug 10ug

Recombinant Human CEACAM6 Protein, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details