Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF506 Rabbit Polyclonal Antibody (FITC)

ZNF506 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q5JVG8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF506

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001138876

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH4 Antibody
CSB-PA015030LA01HU-01 50 µg

MSH4 Antibody

Sign In for Pricing
View Details
MSH4 Antibody
CSB-PA015030LA01HU-02 100 µg

MSH4 Antibody

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to PTEN Induced Putative Kinase 1 (PINK1)
MBS2082533-01 0.1 mL

FITC-Linked Polyclonal Antibody to PTEN Induced Putative Kinase 1 (PINK1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to PTEN Induced Putative Kinase 1 (PINK1)
MBS2082533-02 0.2 mL

FITC-Linked Polyclonal Antibody to PTEN Induced Putative Kinase 1 (PINK1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to PTEN Induced Putative Kinase 1 (PINK1)
MBS2082533-03 0.5 mL

FITC-Linked Polyclonal Antibody to PTEN Induced Putative Kinase 1 (PINK1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to PTEN Induced Putative Kinase 1 (PINK1)
MBS2082533-04 1 mL

FITC-Linked Polyclonal Antibody to PTEN Induced Putative Kinase 1 (PINK1)

Sign In for Pricing
View Details