Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C21orf66 Rabbit Polyclonal Antibody (FITC)

C21orf66 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GCFC, BM020, GCFC1, FSAP105, C21orf66

UniProt

Q9Y5B6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf66

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SERPINA4 shRNA (UAS) - Lentiviral human SERPINA4 shRNA (UAS, RFP) (100)
GTR15323631 1 Vial

Lentiviral human SERPINA4 shRNA (UAS) - Lentiviral human SERPINA4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human BNIP3/BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 ELISA Kit
EK19728 Inquire

Human BNIP3/BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 ELISA Kit

Sign In for Pricing
View Details
5-[ (4-Nitro-1H-pyrazol-1-yl) methyl]thiophene-2-carboxylic acid
GQB45769-01 50 mg

5-[ (4-Nitro-1H-pyrazol-1-yl) methyl]thiophene-2-carboxylic acid

Sign In for Pricing
View Details
5-[ (4-Nitro-1H-pyrazol-1-yl) methyl]thiophene-2-carboxylic acid
GQB45769-02 0.5 g

5-[ (4-Nitro-1H-pyrazol-1-yl) methyl]thiophene-2-carboxylic acid

Sign In for Pricing
View Details
ROR2 (Receptor Tyrosine kinase-like Orphan Receptor 2, NTRKR2, Neurotrophic Tyrosine Kinase Receptor-related 2, Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2) discontinued
220233 100 µL

ROR2 (Receptor Tyrosine kinase-like Orphan Receptor 2, NTRKR2, Neurotrophic Tyrosine Kinase Receptor-related 2, Tyrosine-protein Kinase Transmembrane Receptor ROR2, Neurotrophic Tyrosine Kinase, Receptor-related 2) discontinued

Sign In for Pricing
View Details
RYBP Rabbit pAb
E45R21163N 50 ul

RYBP Rabbit pAb

Sign In for Pricing
View Details