Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C21orf66 Rabbit Polyclonal Antibody (FITC)

C21orf66 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GCFC, BM020, GCFC1, FSAP105, C21orf66

UniProt

Q9Y5B6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf66

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fosl2 AAV siRNA Pooled Vector
20748164 1.0 µg

Fosl2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Map7d2 Pre-designed siRNA Set B
SI108133B 1 Each

Mouse Map7d2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit anti-Vimentin Recombinant Monoclonal Antibody [BLRlOOG]
A700-100CF 100 µg

Rabbit anti-Vimentin Recombinant Monoclonal Antibody [BLRlOOG]

Sign In for Pricing
View Details
Lentiviral human YWHAH shRNA (UAS) - Lentiviral human YWHAH shRNA (UAS) (25)
GTR15326360 1 Vial

Lentiviral human YWHAH shRNA (UAS) - Lentiviral human YWHAH shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0292078 (DDB_G0292078), partial
MBS7082395 Inquire

Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0292078 (DDB_G0292078), partial

Sign In for Pricing
View Details
ARHGDIG Antibody, HRP conjugated
A66246-50UG 50 µg

ARHGDIG Antibody, HRP conjugated

Sign In for Pricing
View Details