Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAML3 Rabbit Polyclonal Antibody (Biotin)

MAML3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GDN, MAM2, CAGH3, ERDA3, MAM-2, TNRC3, mam-3

UniProt

Q96JK9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAML3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGPSQNPG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

122kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS45, CT (VPS45, VPS45A, VPS45B, Vacuolar protein sorting-associated protein 45) (MaxLight 750)
MBS6362761-01 0.1 mL

VPS45, CT (VPS45, VPS45A, VPS45B, Vacuolar protein sorting-associated protein 45) (MaxLight 750)

Sign In for Pricing
View Details
VPS45, CT (VPS45, VPS45A, VPS45B, Vacuolar protein sorting-associated protein 45) (MaxLight 750)
MBS6362761-02 5x 0.1 mL

VPS45, CT (VPS45, VPS45A, VPS45B, Vacuolar protein sorting-associated protein 45) (MaxLight 750)

Sign In for Pricing
View Details
Growth Hormone, Human (hGH, GH, GHN, GH-N, hGH-N, Growth Hormone 1, GH1, IGHD1B, Pituitary Growth Hormone, Somatotropin) (Not for Export EU)
G9000-04J 250 µL

Growth Hormone, Human (hGH, GH, GHN, GH-N, hGH-N, Growth Hormone 1, GH1, IGHD1B, Pituitary Growth Hormone, Somatotropin) (Not for Export EU)

Sign In for Pricing
View Details
CD74 Antibody
V4064-100UG 100 µg

CD74 Antibody

Sign In for Pricing
View Details
Goat anti Rat IgG (H + L)
40C-CB1236 1 mg

Goat anti Rat IgG (H + L)

Sign In for Pricing
View Details
Recombinant Human Ecto-NOX disulfide-thiol exchanger 1 (ENOX1)
CSB-EP007676HUa0-01 20 µg

Recombinant Human Ecto-NOX disulfide-thiol exchanger 1 (ENOX1)

Sign In for Pricing
View Details