Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xpo5 Rabbit Polyclonal Antibody (FITC)

Xpo5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Exp5, RanBp21

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LNFLLSTLQENVNKYQQMKTDASQEAEAQANCRVSIAALNTLAGYIDWVS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11beta-HSD1 Polyclonal Antibody
MBS9242556-01 0.1 mL

11beta-HSD1 Polyclonal Antibody

Sign In for Pricing
View Details
11beta-HSD1 Polyclonal Antibody
MBS9242556-02 5x 0.1 mL

11beta-HSD1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Polyserase-2, PRSS36 ELISA Kit
MBS9340362-01 48 Well

Mouse Polyserase-2, PRSS36 ELISA Kit

Sign In for Pricing
View Details
Mouse Polyserase-2, PRSS36 ELISA Kit
MBS9340362-02 96 Well

Mouse Polyserase-2, PRSS36 ELISA Kit

Sign In for Pricing
View Details
Mouse Polyserase-2, PRSS36 ELISA Kit
MBS9340362-03 5x 96 Well

Mouse Polyserase-2, PRSS36 ELISA Kit

Sign In for Pricing
View Details
Mouse Polyserase-2, PRSS36 ELISA Kit
MBS9340362-04 10x 96 Well

Mouse Polyserase-2, PRSS36 ELISA Kit

Sign In for Pricing
View Details