Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xpo5 Rabbit Polyclonal Antibody (HRP)

Xpo5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Exp5, RanBp21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNFLLSTLQENVNKYQQMKTDASQEAEAQANCRVSIAALNTLAGYIDWVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glod5 siRNA Oligos set (Rat)
21613176 3x 5 nmol

Glod5 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
2,2-Difluoro-2- (4-formylphenoxy) acetic acid
FWB45990-01 50 mg

2,2-Difluoro-2- (4-formylphenoxy) acetic acid

Sign In for Pricing
View Details
2,2-Difluoro-2- (4-formylphenoxy) acetic acid
FWB45990-02 0.5 g

2,2-Difluoro-2- (4-formylphenoxy) acetic acid

Sign In for Pricing
View Details
Phospho-DAXX (Ser495) Rabbit pAb, BF700 conjugated
orb2863081 100 µL

Phospho-DAXX (Ser495) Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
IFluor® 647 Anti-human CD162 Antibody *TC2*
116200F0-AAT 100 Tests

IFluor® 647 Anti-human CD162 Antibody *TC2*

Sign In for Pricing
View Details
Recombinant Burkholderia thailandensis Ribosome maturation factor RimP (rimP)
MBS1364997-01 0.02 mg (E-Coli)

Recombinant Burkholderia thailandensis Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details