Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XPO5 Rabbit Polyclonal Antibody (Biotin)

XPO5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Exp5

UniProt

Q9HAV4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human XPO5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

136kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT11 Antibody (HRP)
orb45383-01 50 µg

GALNT11 Antibody (HRP)

Sign In for Pricing
View Details
GALNT11 Antibody (HRP)
orb45383-02 100 µg

GALNT11 Antibody (HRP)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) INSA2 Polyclonal Antibody
MBS7151248 Inquire

Rabbit anti-Escherichia coli (strain K12) INSA2 Polyclonal Antibody

Sign In for Pricing
View Details
Growth hormone receptor
E58P1140 50 µg

Growth hormone receptor

Sign In for Pricing
View Details
POLR2G, CT (POLR2G, RPB7, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19kD subunit) (MaxLight 650)
MBS6335738-01 0.1 mL

POLR2G, CT (POLR2G, RPB7, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19kD subunit) (MaxLight 650)

Sign In for Pricing
View Details
POLR2G, CT (POLR2G, RPB7, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19kD subunit) (MaxLight 650)
MBS6335738-02 5x 0.1 mL

POLR2G, CT (POLR2G, RPB7, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19kD subunit) (MaxLight 650)

Sign In for Pricing
View Details