Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF500 Rabbit Polyclonal Antibody (Biotin)

ZNF500 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZSCAN50, ZKSCAN18

UniProt

O60304

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF500

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VREQQPESGEEAVVLVEGLQRKPRKHRQRGSELLSDDEVPLGIGGQFLKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_067678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-101 miRNA Antagomir
MNH01030 2x 5.0 nmol

hsa-miR-101 miRNA Antagomir

Sign In for Pricing
View Details
SHC4 (SHC-transforming Protein 4, Rai-like Protein, RaLP, SHC-transforming Protein D, hShcD, Src Homology 2 Domain-containing-transforming Protein C4, SH2 Domain Protein C4, SHCD, UNQ6438/PRO21364) (MaxLight 750)
MBS6235305-01 0.1 mL

SHC4 (SHC-transforming Protein 4, Rai-like Protein, RaLP, SHC-transforming Protein D, hShcD, Src Homology 2 Domain-containing-transforming Protein C4, SH2 Domain Protein C4, SHCD, UNQ6438/PRO21364) (MaxLight 750)

Sign In for Pricing
View Details
SHC4 (SHC-transforming Protein 4, Rai-like Protein, RaLP, SHC-transforming Protein D, hShcD, Src Homology 2 Domain-containing-transforming Protein C4, SH2 Domain Protein C4, SHCD, UNQ6438/PRO21364) (MaxLight 750)
MBS6235305-02 5x 0.1 mL

SHC4 (SHC-transforming Protein 4, Rai-like Protein, RaLP, SHC-transforming Protein D, hShcD, Src Homology 2 Domain-containing-transforming Protein C4, SH2 Domain Protein C4, SHCD, UNQ6438/PRO21364) (MaxLight 750)

Sign In for Pricing
View Details
Monkey Costars family protein C6orf115 (C6orf115) ELISA Kit
MBS7233642-01 48 Well

Monkey Costars family protein C6orf115 (C6orf115) ELISA Kit

Sign In for Pricing
View Details
Monkey Costars family protein C6orf115 (C6orf115) ELISA Kit
MBS7233642-02 96 Well

Monkey Costars family protein C6orf115 (C6orf115) ELISA Kit

Sign In for Pricing
View Details
Monkey Costars family protein C6orf115 (C6orf115) ELISA Kit
MBS7233642-03 5x 96 Well

Monkey Costars family protein C6orf115 (C6orf115) ELISA Kit

Sign In for Pricing
View Details