Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METT10D Rabbit Polyclonal Antibody (FITC)

METT10D Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

METT10D

UniProt

Q86W50

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human METT10D

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tumor Necrosis Factor Alpha Induced Protein 2 (TNFaIP2) ELISA Kit
201-12-5184 96 Tests

Human Tumor Necrosis Factor Alpha Induced Protein 2 (TNFaIP2) ELISA Kit

Sign In for Pricing
View Details
ARTN CRISPR All-in-one AAV vector set (with saCas9)(Rat)
12482156 3x 1.0 µg DNA

ARTN CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
TRIM27, CT (TRIM27, RFP, RNF76, Zinc finger protein RFP, RING finger protein 76, Ret finger protein, Tripartite motif-containing protein 27) (MaxLight 650)
MBS6358250-01 0.1 mL

TRIM27, CT (TRIM27, RFP, RNF76, Zinc finger protein RFP, RING finger protein 76, Ret finger protein, Tripartite motif-containing protein 27) (MaxLight 650)

Sign In for Pricing
View Details
TRIM27, CT (TRIM27, RFP, RNF76, Zinc finger protein RFP, RING finger protein 76, Ret finger protein, Tripartite motif-containing protein 27) (MaxLight 650)
MBS6358250-02 5x 0.1 mL

TRIM27, CT (TRIM27, RFP, RNF76, Zinc finger protein RFP, RING finger protein 76, Ret finger protein, Tripartite motif-containing protein 27) (MaxLight 650)

Sign In for Pricing
View Details
FUK Antibody, HRP conjugated
A64460-50UG 50 µg

FUK Antibody, HRP conjugated

Sign In for Pricing
View Details
mmu-miR-669a-3-3p Primers
MPM00607 150 µL / 10 µM

mmu-miR-669a-3-3p Primers

Sign In for Pricing
View Details